Unlock Your Potential with the DAN DASILVA – Influencer Marketing Academy 2.0 (2017) course only Original price was: $1,297.00.$142.00Current price is: $142.00. on CoursesGB!
At CoursesGB, we provide over 60,000 downloadable digital courses designed for your personal and professional growth. Get expert-guided, self-paced learning at an unbeatable value – often over 80% off original prices. The DAN DASILVA – Influencer Marketing Academy 2.0 (2017) offers practical insights and proven strategies for all skill levels.
Enroll now and elevate your learning with CoursesGB!
Files Included:
Total Size:
Digital products: Get the download link at Account or directly via email.
Support: Lifetime
Download: Unlimited Of Course: DAN DASILVA – Influencer Marketing Academy 2.0 (2017).
Purchase DAN DASILVA – Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $142
When purchasing this course: DAN DASILVA – Influencer Marketing Academy 2.0 (2017), You can get it with the LIFETIME SUPPORT and UNLIMITED DOWNLOAD.
DAN DASILVA – Influencer Marketing Academy 2.0 (2017)
Get DAN DASILVA – Influencer Marketing Academy 2.0 (2017) at the fexmall
Hottest Topic Of 2017…
We’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes
3 Months Of Intensive Training and $140K Later…
So what isInfluencer Marketing Academy
We set out on a mission in early 2016 and trying to find the BIGGEST influencer…
At the CHEAPEST price.
Being able to tap into millions of people to build our lists and eCommerce brands…
We saw TONS of people shortcutting their success, but we didn’t understand HOW Until one day it struck me…
INFLUENCERS!
People are paying others to sponsor their brand and grow their eCommerce stores and help them build a massive list. I decided to reach out to 6 Influencers so they can ‘sponsor’ our product and WOW.
I didn’t have to EVER have to pay based on every 1,000 impressions.. or heck.. I didn’t even have to pay per click! I was paying for a POST! These posts ranged from $30 – $300 depending how big their following was.
Lone and behold I ended up spending $2,000 in a single day to generate over $14,200 back! Now THATS not an ROI to bat an eyelash at… and not only that but that ROI was made in the SAME DAY!
We are able to do this day in and day out. Over and over again. Without failure. So 9 months later… And over $90,000 worth of testing… We are releasing the most anticipated course ever…
Influencer Marketing Academy.
IMA is SUPER easy to use and , ANYONE can implement this system. The students we currently have using this system are generating THOUSANDS of dollars with our simple influencer system.
Your students will LOVE Influencer Marketing Academy and how IN DEPTH we get. We DIVE DEEP into the entire system and show you EVERYTHING. Over the shoulder examples, case studies and YES…. we even provide them with done for you swipe templates to use to contact their desired influencer and the PERFECT image template to upload and send once they find an influencer.
Watch this super short 2 minute video to get a quick sneak peak at whats inside and what we’ve been working so hard on…
Get DAN DASILVA – Influencer Marketing Academy 2.0 (2017) at the fexmall
Here Are the Exact Dates To Help Schedule Your Mailings
January 3rd – Free Book Released + Free Video #1
January 5th – 2rd Video Released + Workshop Invite
January 7th – 3rd Video Released + Workshop Invite
January 8th – 4th Micro Video Released + Workshop Invite
January 9th – 1st Workshop / Cart Open
January 10th – 1st Workshop Encore
January 12th – Second Workshop
January 13th – Second Workshop Encore
January 14th – Last Workshop Invitation
January 15th – Last Workshop Invitation
January 16th – Last Workshop + Cart Closing
The Fine Print
As an Affiliate you agree to the following:
The new FTC Guidelines for affiliate marketing came into effect on December 1st 2009. As an affiliate or JV partner for ‘Influencer Marketing Academy’, you’ve read and fully agree to the terms listed on the Official FTC Website – http://www.ftc.gov/bcp/guides/guides.shtm to ensure that your promotions are compliant with the new guidelines.
ABSOLUTELY NO NEGATIVE MARKETING. No “This is a Scam” and turning around to promote the product with your affiliate link. This will not only get ALL commissions negated. You will not be allowed to promote any future products from our company.
Also, if not removed immediately, we reserve the right to take legal action. We’re not trying to be unfair or crude, but guys, come on, we have a right to protect our brand. That kind of marketing doesn’t help anyone and isn’t fair to our company. Of course you’re entitled to your opinion, but we still have the right to protect how our affiliate links are used ?
We have a minimum threshold of $200 in commissions for our monthly payout..
To be eligible for any lead prize, your conversion to sales must not be significantly below the average. This is at our sole discretion
Payment will be processed on the 20th of Each Month for the sales generated 2 month prior. You will be paid in FULL.
As an affiliate, if you purchase the product under your own link, we will VOID YOUR COMMISSIONS.
Affiliate sales must qualify as legitimate transactions based on our terms and conditions. All transactions will be monitored and automatically reviewed. If any sales transactions associated with your affiliate ID and/or account do not line up with the types of qualified sales most typically seen through normal traffic generation methods, our system will flag your account.
This will trigger a manual review of your transactions, and if necessary your sites and traffic practices. Any questionable transactions will be investigated. We reserve the right to withhold payment of commissions until the review process is completed. If, after a manual review, any transactions are deemed questionable, any earned commissions on those transactions could be invalidated and you may not be paid for them.
Affiliates are not permitted to do use any keyword based advertising (such as search engine PPC) targetting a keyword of any of Dan Dasilva / Influencer Marketing Academy brands (For example, you may not target the keyword “Influencer Marketing Academy” in your PPC campaign)
Affiliates are not permitted to use domain names containing any of Dan Dasilva / Influencer Marketing Owned brands to promote. For example, you may not use influencermarketingacademyreview.net, because it has the term “InfluencerMarketingAcademy” in it, which is one of our brands.
You may not give away any of OUR material (for example eBook or report) under any circumstances without prior written consent. (for example, you may not collect an email address in exchange for our eBook).
Please make sure that your review/bonus site does not accidentally (or purposely) represent as us in any way – so using our logo on your page is probably fine, but in your header, maybe not – use your discretion.
You may not use your affiliate link on any of OUR pages (such as comments section)
We don’t allow cashbacks, rebates, giftcards, ipads etc.. Information product bonuses are allowed and encouraged.
During further review you may be asked for the following:
Your full name
Your phone number (in case we need to interview you)
Method of promo (i.e.: email marketing, Facebook, Solo, Blog, etc)
Proof of Proof of method(s) used to promo ( snapshot of email list, Facebook ad, solo ad receipt, blog display, website, etc)
Get DAN DASILVA – Influencer Marketing Academy 2.0 (2017) at the fexmall
Archive : DAN DASILVA – Influencer Marketing Academy 2.0 (2017)
Purchase DAN DASILVA – Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $142
Unlock Lifetime Learning and Career Growth with the DAN DASILVA – Influencer Marketing Academy 2.0 (2017) course only Original price was: $1,297.00.$142.00Current price is: $142.00. at CoursesGB!
Invest in your future with the DAN DASILVA – Influencer Marketing Academy 2.0 (2017) course at CoursesGB and gain immediate, lifetime access to expertly crafted digital content designed to boost your career and personal development. As a leading platform for downloadable courses, we offer unparalleled value and convenience.
Why Choose CoursesGB?
- Lifetime Access: Enjoy unlimited access to your purchased courses, forever.
- Massive Savings: Get top-tier courses at prices up to 80% lower than original sales pages.
- Secure Payments: Shop with confidence using our secure payment methods (PayPal, Stripe).
- Practical Knowledge: Empower your career with actionable, real-world skills from over 60,000 diverse courses.
- Instant Access: Start learning immediately after purchase via your account dashboard or email for most courses.
- Learn Anywhere: Access your courses seamlessly on any device (desktop, mobile, tablet).
Start your learning journey today and discover the CoursesGB advantage!

10X Formula Strategy – Simpler Trading
ACPARE - Stabilized Transaction Mastery
$20K Daily On Clickbank And FB With This 3 Step System – Commission Hero
'MAGNETIC INFLUENCE' - Magnet for Money, Charisma, Confidence! - Dani Johnson
Qigong 101 - Flowing Zen
$42000 Mastermind Manuscript 2008 - Rich Schefren
Advanced Nuances & Exceptions ECourse – Jim Dalton
Info Summit 2017 Presentations - Dan Kennedy
Breakthrough Advertising - Eugene Schwartz
Code 2 Conversions - Chris Rocheleau
"Male Physique Training Templates" - Renaissance Periodization
The New Self-Sufficient Gardener - John Seymour
$300 a day YouTube Affiliate Marketing Blueprint - Hunter Edwards
0-100K Case Study – Grant Ambrose
"Saturn's Birthday" & New Moon: The Ultimate Saturn Karma Clearing for You & 45 Ancestral Generations of Intractable, Long-Term, Chronic Problems
"Is Your Soul Allowing You To Heal?" -- All 7 Recordings in the Series (6 Hours of Audio Clearings)
Fast Track to Wealth - Ron Legand
'Quantum' Chakra Clearing and Balancing Series - Jonette Crowley
$100k Social Workshop
33 Courses Collection - Gerald Kein
...and Forgive Them Their Debts - Michael Hudson
$1K A Day Fast Track – Merlin Holmes
10x Facebook Ads – Joanna Wiebe
Embracing Change (Tim Phizackerley) - PSTEC
007s Guide to a Womans Heart – Elite Training Bundle
